PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr014306.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 604aa    MW: 66578.6 Da    PI: 4.8982
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr014306.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.52.5e-1102346032374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   ++Ll+cA+ ++++d+ +a + L rl+e  s +gdp++R+a+yf+eAL++r++     l +  + +++ ++  ++ + ++k++++++P+ kf+hltaN
  Pbr014306.1 234 LKALLDCAR-LTESDTDRAVKSLIRLRESISDHGDPTERVAFYFAEALHSRVSV----LQSEKNFTTAYDTPCEDFTLSYKALNDACPYSKFAHLTAN 326
                  689******.566799************************************98....44444555555555999*********************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  qaIlea+e+++++Hi+Df+i qG+QW+aLlqaLa+R+ g+p s+Ri g+ +p+ g   + +l +tg+rL++fA+ l+++fef++ + + +++l+ + +
  Pbr014306.1 327 QAILEATERATKIHIVDFGIVQGVQWAALLQALATRSTGKPvSIRISGIPAPSLGdsPAASLFATGNRLREFAKLLELNFEFEP-ILTPVNELDESCF 423
                  *************************************77777**********999889999***********************.799********** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  r++p+Eala n++lql++llde+ +  +   + Lkl ksl+P++v++ e ea++n+ +F+ rf +al+yy+alf+sle ++ r+s er kvEr llgr
  Pbr014306.1 424 RFEPDEALAMNFMLQLYNLLDEKPTAVH---SALKLAKSLNPQIVTLGEYEANLNRVEFASRFKNALKYYTALFESLEPNMTRDSPERLKVERLLLGR 518
                  ********************99999999...9****************************************************************** PP

         GRAS 293 eivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                  +i  +v  e++  +rer e +e+W+  +e++GF+pv+ls++ ++qak ll +++ s  y+++e+   ++ l W++ pL++vS+Wr
  Pbr014306.1 519 RIGGLVGPEQSGtKRERFEDKEQWKYLMESSGFEPVALSHYSVSQAKILLWNYNySSLYSLKESPPGFLsLSWSEVPLFTVSSWR 603
                  *******9998779****************************************9999****99877777**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.584207581IPR005202Transcription factor GRAS
PfamPF035148.6E-108234603IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QKQQQEQQQP QQHHQQPPLG AFSLTPWPNN THHTLAQSPN  60
LGFGLTGSGF SDPFQMPGGS DAGGEPGFPF PNLDHHAAGF RFSDLGGGGA AEFDSDEWMD  120
SIIGGGDSTD SSNMPYACDT WQGNNADFGL YGADPFQPHC PSRLSNTCSP PSDLNRVVFS  180
ETQNQLPTWT PPPPQQLHQV SIKESKSADH PSLKNDAVGV SLGSPEIESA PPLLKALLDC  240
ARLTESDTDR AVKSLIRLRE SISDHGDPTE RVAFYFAEAL HSRVSVLQSE KNFTTAYDTP  300
CEDFTLSYKA LNDACPYSKF AHLTANQAIL EATERATKIH IVDFGIVQGV QWAALLQALA  360
TRSTGKPVSI RISGIPAPSL GDSPAASLFA TGNRLREFAK LLELNFEFEP ILTPVNELDE  420
SCFRFEPDEA LAMNFMLQLY NLLDEKPTAV HSALKLAKSL NPQIVTLGEY EANLNRVEFA  480
SRFKNALKYY TALFESLEPN MTRDSPERLK VERLLLGRRI GGLVGPEQSG TKRERFEDKE  540
QWKYLMESSG FEPVALSHYS VSQAKILLWN YNYSSLYSLK ESPPGFLSLS WSEVPLFTVS  600
SWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1482326033375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371590.10.0PREDICTED: scarecrow-like protein 4
RefseqXP_009371591.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLM5VW270.0M5VW27_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s12520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62803449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein